Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 5A
LigandBDBM50116713
Substrate/Competitorn/a
Meas. Tech.ChEBML_155368
IC50 4750±n/a nM
Citation Shin, HJKim, HJKwak, JHChun, HOKim, JHPark, HKim, DHLee, YS A prenylated flavonol, sophoflavescenol: a potent and selective inhibitor of cGMP phosphodiesterase 5. Bioorg Med Chem Lett12:2313-6 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 5A
Name:Phosphodiesterase 5A
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:94547.60
Organism:Rattus norvegicus
Description:ChEMBL_155367
Residue:833
Sequence:
MLPFGDKTRDMVNAWFSERVHNIPVCKEGIRAHTESCSCSLPQSPHADNTTPGAPARKIS
ASEFDRPLRPIVVKDSEGTVSFLSDSGKKEQMPLTSPRFDSDEGDQCSRLLELVKDISSH
LDVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLVSRLFDVAEGSTLEEASNNCIR
LEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVA
QAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFE
EQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCPDSFSRVFQMEWEEVGKSSEPLTREH
DANKINYMYAQYVKNTMEPLNIPDVTKDNRFPWTNENMGHINTHCIRSLLCTPIKNGKKN
KVIGVCQLVNKMEEKTGKIKAFNQNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVT
LEVLSYHASAAEEETRELQALAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDL
NLVQNFQMKHEVLCRWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLE
TLALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSTMEHHHFDQCLMVLNSPGNQILS
GLSIEEYKTTLKIIKQAILATDLALYIKRRGEFFELIRKNEFSFEDPLQKELFLAMLMTA
CDLSAITKPWPIQQRIAELVAAEFFDQGDRERKELNMEPADLMNREKKNKIPSMQVGFID
AICLQLYEALTHVSEDCLPLLDGCRKNRQKWQALADQQEKTLLNGESGQAKRD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50116713
NameBDBM50116713
Synonyms:(2R,3R)-2-(2,4-Dihydroxy-phenyl)-3,7-dihydroxy-8-(5-hydroxy-2-isopropenyl-5-methyl-hexyl)-5-methoxy-chroman-4-one | CHEMBL77703
TypeSmall organic molecule
Emp. Form.C26H32O8
Mol. Mass.472.5275
SMILESCOc1cc(O)c(CC(CCC(C)(C)O)C(C)=C)c2O[C@@H]([C@@H](O)C(=O)c12)c1ccc(O)cc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a