Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A3
LigandBDBM50124120
Substrate/Competitorn/a
Meas. Tech.ChEBML_32003
Ki 326±n/a nM
Citation Lim, MHKim, HOMoon, HRLee, SJChun, MWGao, ZGMelman, NJacobson, KAKim, JHJeong, LS Design, synthesis and binding affinity of 3'-fluoro analogues of Cl-IB-MECA as adenosine A3 receptor ligands. Bioorg Med Chem Lett13:817-20 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A3
Name:Adenosine receptor
Synonyms:A3 adenosine receptor (hA3) | Adenosine A3 receptor (A3AR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36197.32
Organism:Homo sapiens (Human)
Description:P0DMS8
Residue:318
Sequence:
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50124120
NameBDBM50124120
Synonyms:2-[2-chloro-6-(methylamino)-9H-purin-9-yl]-4-fluoro-5-(hydroxymethyl)tetrahydrofuran-3-ol | CHEMBL168843
TypeSmall organic molecule
Emp. Form.C11H13ClFN5O3
Mol. Mass.317.704
SMILESCNc1nc(Cl)nc2n(cnc12)C1OC(CO)C(F)C1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a