Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V2 receptor (V2)
LigandBDBM50146310
Substrate/Competitorn/a
Meas. Tech.ChEMBL_214261
Ki 3.7±n/a nM
Citation Matthews, JMHoekstra, WJDyatkin, ABHecker, LRHlasta, DJPoulter, BLAndrade-Gordon, Pde Garavilla, LDemarest, KTEricson, EGunnet, JWHageman, WLook, RMoore, JBReynolds, CHMaryanoff, BE Potent nonpeptide vasopressin receptor antagonists based on oxazino- and thiazinobenzodiazepine templates. Bioorg Med Chem Lett14:2747-52 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V2 receptor (V2)
Name:Vasopressin receptor
Synonyms:AVPR V2 | AVPR2 | Antidiuretic hormone receptor | Renal-type arginine vasopressin receptor | VASOPRESSIN V2 | Vasopressin V2 receptor
Type:Receptor
Mol. Mass.:40295.28
Organism:Homo sapiens (Human)
Description:P30518
Residue:371
Sequence:
MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLA
ALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQ
RNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGP
SERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEA
PLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTT
ASSSLAKDTSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50146310
NameBDBM50146310
Synonyms:Biphenyl-2-carboxylic acid [4-((S)-3,4,11,11a-tetrahydro-1H,5H-2-oxa-4a,10-diaza-dibenzo[a,d]cycloheptene-10-carbonyl)-phenyl]-amide | CHEMBL93861
TypeSmall organic molecule
Emp. Form.C32H29N3O3
Mol. Mass.503.591
SMILESO=C(Nc1ccc(cc1)C(=O)N1C[C@H]2COCCN2Cc2ccccc12)c1ccccc1-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a