Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNorepinephrine Monoamine transporters
LigandBDBM50029153
Substrate/Competitorn/a
Meas. Tech.ChEBML_178953
IC50 3000±n/a nM
Citation Gueremy, CAudiau, FChampseix, naUzan, ALe Fur, GRataud, J 3-(4-Piperidinylalkyl)indoles, selective inhibitors of neuronal 5-hydroxytryptamine uptake. J Med Chem23:1306-10 (1981) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Norepinephrine Monoamine transporters
Name:Monoamine transporters; Norepininephrine & dopamine
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:66787.87
Organism:Rattus norvegicus
Description:ChEMBL_1463061
Residue:597
Sequence:
MVTRTRETWGKKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLF
YMELALGQFNREGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFASFTLN
LPWTNCGHAWNSPNCTDPKLLNASVLGDHTKYSKYKFTPAAEFYERGVLHLHESSGIHDI
GLPQWQLLLCLMVVIVVLYVSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNG
INAYLHIDFYRLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSTIN
CVTSFISGFAIFSILGYMAHEHKVKIEDVATEGAGLVFVLYPEAISTLSGSTFWAVLFFL
MLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLFTCAVTLGTFLLAMFCITKGGIYVLT
LLDTFAAGTSILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFKPGLYWRLCWKFVSPAFLL
FVVVVSIINFKPLTYDDYVYPPWANWVGWGIALSSMILVPAYVIYKFFSIRGSLWERVAY
GITPENEHHLLALEIELSSLQSFVITSCPIDPLLSSFLFISCQKTLVFKKSGPAPLI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029153
NameBDBM50029153
Synonyms:5-Methoxy-3-(2-piperidin-4-yl-ethyl)-1H-indole | CHEMBL24731
TypeSmall organic molecule
Emp. Form.C16H22N2O
Mol. Mass.258.3587
SMILESCOc1ccc2[nH]cc(CCC3CCNCC3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a