Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenylate kinase 2
LigandBDBM14487
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32055
Ki 87000000±n/a nM
Citation Kappler, FHai, TTAbo, MHampton, A Species- or isozyme-specific enzyme inhibitors. 8. Synthesis of disubstituted two-substrate condensation products as inhibitors of rat adenylate kinases. J Med Chem25:1179-84 (1983) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenylate kinase 2
Name:Adenylate kinase 2
Synonyms:n/a
Type:n/a
Mol. Mass.:26380.21
Organism:Rattus norvegicus
Description:n/a
Residue:239
Sequence:
MAPNALAPEPEHPEGIRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSEL
GKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVKQAEMLDDLMDKRKE
KLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEAMKDDITGEPLIRRSDDNE
KALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDVVFASILAAFSKATCKDLVMFV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14487
n/a
NameBDBM14487
Synonyms:(2R,3R,4S,5R)-2-(6-amino-9H-purin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol | Adenine-beta-D-arabinofuranoside | Adenosine | CHEMBL477 | N6-Methylado | [U-14C]adenosine | cid_191 | cid_60961
TypeNucleoside or nucleotide
Emp. Form.C10H13N5O4
Mol. Mass.267.2413
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: