Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenylate kinase 3 alpha like 1
LigandBDBM50027446
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32212
Ki 2900000±n/a nM
Citation Hai, TTPicker, DAbo, MHampton, A Species- or isozyme-specific enzyme inhibitors. 7. Selective effects in inhibitions of rat adenylate kinase isozymes by adenosine 5'-phosphate derivatives. J Med Chem25:806-12 (1982) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenylate kinase 3 alpha like 1
Name:Adenylate kinase 3 alpha like 1
Synonyms:AK 3 | Adenylate kinase 3 | Adenylate kinase 3 alpha-like 1 | GTP:AMP phosphotransferase mitochondrial
Type:PROTEIN
Mol. Mass.:25443.58
Organism:Rattus norvegicus
Description:ChEMBL_1340551
Residue:227
Sequence:
MGASGRLLRAVIMGAPGSGKGTGSSRITKHFELKHLSSGDLLRQNMLQGTEIAVLAKSFI
DQGKLIPDDDMTRLALHELKNLTQCSWLLDGFPRTLPQAEALDRVYQIDTVINLNVPFEV
IKLRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQT
EPVLQYYQKKGVLETFSGTETNKIRPHVYSFLQMKVPETIQKASVTP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027446
NameBDBM50027446
Synonyms:CHEMBL355659 | Phosphoric acid mono-[6-(6-amino-purin-9-yl)-2-methyl-tetrahydro-furo[3,4-d][1,3]dioxol-4-ylmethyl] ester
TypeSmall organic molecule
Emp. Form.C12H16N5O7P
Mol. Mass.373.2585
SMILESCC1OC2C(COP(O)(O)=O)OC(C2O1)n1cnc2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a