Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenylate kinase 1
LigandBDBM50027451
Substrate/Competitorn/a
Meas. Tech.ChEBML_32222
Ki 1700000±n/a nM
Citation Hai, TTPicker, DAbo, MHampton, A Species- or isozyme-specific enzyme inhibitors. 7. Selective effects in inhibitions of rat adenylate kinase isozymes by adenosine 5'-phosphate derivatives. J Med Chem25:806-12 (1982) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenylate kinase 1
Name:Adenylate kinase 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:21585.03
Organism:Rattus norvegicus
Description:ChEMBL_29909
Residue:194
Sequence:
MEDKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSSRGKMLSSI
MEKGELVPLETVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPTLLLYVDA
GPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVISFYDKRGIVRKVNAEGSVD
TVFSQVCTYLDSLK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027451
NameBDBM50027451
Synonyms:CHEMBL166430 | CHEMBL3143591 | Phosphoric acid mono-[5-(6-amino-purin-9-yl)-4-hydroxy-3-methoxy-tetrahydro-furan-2-ylmethyl] ester
TypeSmall organic molecule
Emp. Form.C11H16N5O7P
Mol. Mass.361.2478
SMILESCO[C@@H]1[C@@H](COP(O)(O)=O)O[C@H]([C@@H]1O)n1cnc2c(N)ncnc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a