Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIndolethylamine N-methyltransferase
LigandBDBM22111
Substrate/Competitorn/a
Meas. Tech.ChEMBL_89037
Ki 700000±n/a nM
Citation Benghiat, ECrooks, PA Multisubstrate adducts as potential inhibitors of S-adenosylmethionine dependent methylases: inhibition of indole N-methyltransferase by (5'-deoxyadenosyl)[3-(3-indolyl)prop-1-yl]methylsulfonium and (5'-deoxyadenosyl)[4-(3-indolyl)but-1-yl]methylsulfonium salts. J Med Chem26:1470-7 (1983) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Indolethylamine N-methyltransferase
Name:Indolethylamine N-methyltransferase
Synonyms:Amine N-methyltransferase | Aromatic alkylamine N-methyltransferase | Arylamine N-methyltransferase | Indolamine N-methyltransferase
Type:PROTEIN
Mol. Mass.:28884.19
Organism:Homo sapiens (Human)
Description:ChEMBL_1333668
Residue:263
Sequence:
MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLI
DIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGN
SGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAAL
CNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQ
SYSVTNAANNGVCFIVARKKPGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22111
NameBDBM22111
Synonyms:(2R,3R,4S,5S)-2-(6-amino-9H-purin-9-yl)-5-[(methylsulfanyl)methyl]oxolane-3,4-diol | (2R,3R,4S,5S)-2-(6-aminopurin-9-yl)-5-(methylsulfanylmethyl)oxolane-3,4-diol | 5'-Methylthioado | 5-methylthioadenosine | CHEMBL277041 | MTA
TypeNucleoside or nucleotide
Emp. Form.C11H15N5O3S
Mol. Mass.297.334
SMILESCSC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a