Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin-converting enzyme
LigandBDBM21642
Substrate/Competitorn/a
Meas. Tech.ChEMBL_34798
IC50 27±n/a nM
Citation Suh, JTSkiles, JWWilliams, BEYoussefyeh, RDJones, HLoev, BNeiss, ESSchwab, AMann, WSKhandwala, A Angiotensin-converting enzyme inhibitors. New orally active antihypertensive (mercaptoalkanoyl)- and [(acylthio)alkanoyl]glycine derivatives. J Med Chem28:57-66 (1985) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin-converting enzyme
Name:Angiotensin-converting enzyme
Synonyms:ACE | Angiotensin-converting enzyme, soluble form | CD_antigen=CD143 | Dipeptidyl carboxypeptidase I | Kininase II
Type:n/a
Mol. Mass.:150405.15
Organism:Oryctolagus cuniculus
Description:n/a
Residue:1310
Sequence:
MGAAPGRRGPRLLRPPPPLLLLLLLLRPPPAALTLDPGLLPGDFAADEAGARLFASSYNS
SAEQVLFRSTAASWAHDTNITAENARRQEEEALLSQEFAEAWGKKAKELYDPVWQNFTDP
ELRRIIGAVRTLGPANLPLAKRQQYNSLLSNMSQIYSTGKVCFPNKTASCWSLDPDLNNI
LASSRSYAMLLFAWEGWHNAVGIPLKPLYQEFTALSNEAYRQDGFSDTGAYWRSWYDSPT
FEEDLERIYHQLEPLYLNLHAYVRRVLHRRYGDRYINLRGPIPAHLLGNMWAQSWESIYD
MVVPFPDKPNLDVTSTMVQKGWNATHMFRVAEEFFTSLGLLPMPPEFWAESMLEKPEDGR
EVVCHASAWDFYNRKDFRIKQCTQVTMDQLSTVHHEMGHVQYYLQYKDQPVSLRRANPGF
HEAIGDVLALSVSTPAHLHKIGLLDHVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRW
GVFSGRTPSSRYNFDWWYLRTKYQGICPPVVRNETHFDAGAKFHIPSVTPYIRYFVSFVL
QFQFHQALCMEAGHQGPLHQCDIYQSTRAGAKLRAVLQAGCSRPWQEVLKDMVASDALDA
QPLLDYFQPVTQWLQEQNERNGEVLGWPEYQWRPPLPNNYPEGIDLVTDEAEASRFVEEY
DRSFQAVWNEYAEANWNYNTNITTEASKILLQKNMQIANHTLTYGNWARRFDVSNFQNAT
SKRIIKKVQDLQRAVLPVKELEEYNQILLDMETIYSVANVCRVDGSCLQLEPDLTNLMAT
SRKYDELLWVWTSWRDKVGRAILPYFPKYVEFTNKAARLNGYVDAGDSWRSMYETPTLEQ
DLERLFQELQPLYLNLHAYVGRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVA
PFPSASTMDATEAMIKQGWTPRRMFEEADKFFISLGLLPVPPEFWNKSMLEKPTDGREVV
CHASAWDFYNGKDFRIKQCTTVNMEDLVVVHHEMGHIQYFMQYKDLPVALREGANPGFHE
AIGDVLALSVSTPKHLHSINLLSSEGGGYEHDINFLMKMALDKIAFIPFSYLVDEWRWRV
FDGSITKENYNQEWWSLRLKYQGLCPPAPRSQGDFDPGAKFHIPSSVPYIRYFVSFIIQF
QFHEALCKAAGHTGPLHTCDIYQSKEAGKRLADAMKLGYSKPWPEAMKVITGQPNMSASA
MMNYFKPLMDWLLTENGRHGEKLGWPQYTWTPNSARSEGSLPDSGRVNFLGMNLDAQQAR
VGQWVLLFLGVALLLASLGLTQRLFSIRYQSLRQPHHGPQFGSEVELRHS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21642
NameBDBM21642
Synonyms:(2S)-1-[(2S)-2-methyl-3-sulfanylpropanoyl]pyrrolidine-2-carboxylic acid | CHEMBL1560 | Capozide | Captopril | Lopirin | SQ 14,225 | SQ14534
TypeSmall organic molecule
Emp. Form.C9H15NO3S
Mol. Mass.217.285
SMILESC[C@H](CS)C(=O)N1CCC[C@H]1C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a