Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H2 receptor
LigandBDBM50026283
Substrate/Competitorn/a
Meas. Tech.ChEBML_85684
IC50 30000±n/a nM
Citation Martinez, JBali, JPMagous, RLaur, JLignon, MFBriet, CNisato, DCastro, B Structure-activity relationships of C-terminal tri- and tetrapeptide fragments that inhibit gastrin activity. J Med Chem28:273-8 (1985) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H2 receptor
Name:Histamine H2 receptor
Synonyms:Gastric receptor I | H2R | HISTAMINE H2
Type:Enzyme Catalytic Domain
Mol. Mass.:40269.37
Organism:RAT
Description:HISTAMINE H2 HRH2 RAT::P25102
Residue:358
Sequence:
MEPNGTVHSCCLDSMALKVTISVVLTTLILITIAGNVVVCLAVSLNRRLRSLTNCFIVSL
AATDLLLGLLVLPFSAIYQLSFTWSFGHVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
TDPLRYPVLVTPVRVAISLVFIWVISITLSFLSIHLGWNSRNGTRGGNDTFKCKVQVNEV
YGLVDGLVTFYLPLLIMCVTYYRIFKIAREQAKRINHISSWKAATIREHKATVTLAAVMG
AFIICWFPYFTAFVYRGLRGDDAINEAVEGIVLWLGYANSALNPILYAALNRDFRTAYQQ
LFHCKFASHNSHKTSLRLNNSLLPRSQSREGRWQEEKPLKLQVWSGTELTHPQGNPIR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50026283
NameBDBM50026283
Synonyms:1-(2-{2-[2-tert-Butoxycarbonylamino-3-(1H-indol-3-yl)-propionylamino]-4-methyl-pentanoylamino}-3-carboxy-propionyl)-piperidine-2-carboxylic acid | CHEMBL2370238
TypeSmall organic molecule
Emp. Form.C32H45N5O9
Mol. Mass.643.7278
SMILESCC(C)C[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)OC(C)(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCCC[C@H]1C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a