Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase (ALR2)
LigandBDBM50022401
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31633
IC50 1000±n/a nM
Citation Sarges, RSchnur, RCBelletire, JLPeterson, MJ Spiro hydantoin aldose reductase inhibitors. J Med Chem31:230-43 (1988) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldose reductase (ALR2)
Name:Aldose reductase
Synonyms:Aldose reductase
Type:Protein
Mol. Mass.:35916.27
Organism:Bos taurus (Cattle)
Description:n/a
Residue:315
Sequence:
AHNIVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLALQA
KLQEQVVKREDLFIVSKLWCTYHDKDLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKD
FFPLDEDGNVIPSEKDFVDTWTAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPA
VNQIECHPYLTQEKLIQYCNSKGIVVTAYSPLGSPDRPWAKPEDPSILEDPRIKAIADKY
NKTTAQVLIRFPIQRNLIVIPKSVTPERIAENFQVFDFELDKEDMNTLLSYNRDWRACAL
VSCASHRDYPFHEEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50022401
NameBDBM50022401
Synonyms:8-phenylspiro[3,4-dihydro-2H-chromene-4,4'-(tetrahydro-1'H-imidazole)]-2',5'-dione(1/8H2O) | CHEMBL420024
TypeSmall organic molecule
Emp. Form.C17H14N2O3
Mol. Mass.294.3047
SMILESO=C1NC(=O)C2(CCOc3c(cccc23)-c2ccccc2)N1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a