Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A1 receptor
LigandBDBM82558
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29101
Kd 37±n/a nM
Citation Linden, JPatel, AEarl, CQCraig, RHDaluge, SM 125I-labeled 8-phenylxanthine derivatives: antagonist radioligands for adenosine A1 receptors. J Med Chem31:745-51 (1988) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine A1 receptor
Name:Adenosine A1 receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low
Type:Enzyme Catalytic Domain
Mol. Mass.:36602.99
Organism:BOVINE
Description:ADENOSINE 0 BOVINE::P28190
Residue:326
Sequence:
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPRTYFHTCLKVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
PRRAVVAITGCWILSFVVGLTPMFGWNNLSAVERDWLANGSVGEPVIECQFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYMEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHMPRILIYIAIFLSHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPVDEDAPAERPDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82558
NameBDBM82558
Synonyms:CAS_163889 | CHEMBL355370 | I-ABOPX | NSC_163889
TypeSmall organic molecule
Emp. Form.C23H22IN5O5
Mol. Mass.575.3558
SMILESCCCn1c(=O)n(Cc2ccc(N)c(I)c2)c2nc([nH]c2c1=O)-c1ccc(OCC(O)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a