Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThymidylate synthase
LigandBDBM50023642
Substrate/Competitorn/a
Meas. Tech.ChEMBL_209978
Ki 97800±n/a nM
Citation Chang, GSchwepler, DDecedue, CJBalzarini, JDe Clercq, EMertes, MP Linear free energy relationship studies of enzyme active site binding: thymidylate synthase. J Med Chem31:1141-7 (1988) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Thymidylate synthase
Name:Thymidylate synthase
Synonyms:TS | TSase
Type:PROTEIN
Mol. Mass.:34957.15
Organism:Mus musculus
Description:ChEMBL_1340097
Residue:307
Sequence:
MLVVGSELQSDAQQLSAEAPRHGELQYLRQVEHILRCGFKKEDRTGTGTLSVFGMQARYS
LRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVRIWDANGSRDFLDSLGFSAR
QEGDLGPVYGFQWRHFGAEYKDMDSDYSGQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKD
LPLMALPPCHALCQFYVVNGELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLQPG
DFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLKILRKVETIDDFKVEDFQIEGYNPHPT
IKMEMAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50023642
NameBDBM50023642
Synonyms:Phosphoric acid mono-{5-[5-(4-cyano-phenyl)-2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-yl]-3-hydroxy-tetrahydro-furan-2-ylmethyl} ester
TypeSmall organic molecule
Emp. Form.C16H14N3O8P
Mol. Mass.407.2725
SMILESOC1CC(OC1COP([O-])([O-])=O)n1cc(-c2ccc(cc2)C#N)c(=O)[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM50023642
Synonyms:Phosphoric acid mono-{5-[5-(4-cyano-phenyl)-2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-yl]-3-hydroxy-tetrahydro-furan-2-ylmethyl} ester
TypeSmall organic molecule
Emp. Form.C16H14N3O8P
Mol. Mass.407.2725
SMILESOC1CC(OC1COP([O-])([O-])=O)n1cc(-c2ccc(cc2)C#N)c(=O)[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: