Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeprilysin
LigandBDBM50018218
Substrate/Competitorn/a
Meas. Tech.ChEBML_144760
IC50 2.5±n/a nM
Citation Hernandez, JFSoleilhac, JMRoques, BPFournié-Zaluski, MC Retro-inverso concept applied to the complete inhibitors of enkephalin-degrading enzymes. J Med Chem31:1825-31 (1988) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neprilysin
Name:Neprilysin
Synonyms:Atriopeptidase | CD10 antigen | CD_antigen=CD10 | Enkephalinase | NEP | Neutral Endopeptidase | Neutral endopeptidase 24.11
Type:Enzyme
Mol. Mass.:85570.75
Organism:Oryctolagus cuniculus (rabbit)
Description:NEP was purified to homogeneity from rabbit kidney.
Residue:750
Sequence:
MGRSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTVIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATAEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKD
VLQEPKTEDIVAVQKAKTLYRSCVNETAIDSRGGQPLLKLLPDVYGWPVATQNWEQTYGT
SWSAEKSIAQLNSNYGKKVLINFFVGTDDKNSMNHIIHIDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMIAVAKLIRQEEGLPIDENQISVEMNKVMELEKEIANATTKSEDRNDPMLLY
NKMTLAQIQNNFSLEINGKPFSWSNFTNEIMSTVNINIPNEEDVVVYAPEYLIKLKPILT
KYFPRDFQNLFSWRFIMDLVSSLSRTYKDSRNAFRKALYGTTSESATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERI
GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWITGAA
IVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSANNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGIGQAYR
AYQNYVKKNGEEKLLPGIDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GSLQNSVEFSEAFQCPKNSYMNPEKKCRVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50018218
NameBDBM50018218
Synonyms:(R,S)2-(2-Benzyl-3-hydroxycarbamoyl-propionylamino)-3-phenyl-propionic acid | 2-(2-Benzyl-3-hydroxycarbamoyl-propionylamino)-3-phenyl-propionic acid | CHEMBL37418
TypeSmall organic molecule
Emp. Form.C20H22N2O5
Mol. Mass.370.3991
SMILESONC(=O)CC(Cc1ccccc1)C(=O)NC(Cc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a