Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThymidine kinase, cytosolic
LigandBDBM50013116
Substrate/Competitorn/a
Meas. Tech.ChEMBL_208196
Ki 975000±n/a nM
Citation Palomino, EMeltsner, BRKessel, DHorwitz, JP Synthesis and in vitro evaluation of some modified 4-thiopyrimidine nucleosides for prevention or reversal of AIDS-associated neurological disorders. J Med Chem33:258-63 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thymidine kinase, cytosolic
Name:Thymidine kinase, cytosolic
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:25476.50
Organism:Homo sapiens (Human)
Description:ChEMBL_1333884
Residue:234
Sequence:
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSSFCTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVI
VAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADK
YHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50013116
NameBDBM50013116
Synonyms:Benzoic acid 5-(2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-yl)-tetrahydro-furan-2-ylmethyl ester (ddUrd) | CHEMBL88993
TypeSmall organic molecule
Emp. Form.C16H16N2O5
Mol. Mass.316.3086
SMILESO=C(OC[C@@H]1CC[C@@H](O1)n1ccc(=O)[nH]c1=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a