Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 19A1
LigandBDBM50014324
Substrate/Competitorn/a
Meas. Tech.ChEBML_51212
EC50 55±n/a nM
Citation Jones, CDWinter, MAHirsch, KSStamm, NTaylor, HMHolden, HEDavenport, JDKrumkalns, EVSuhr, RG Estrogen synthetase inhibitors. 2. Comparison of the in vitro aromatase inhibitory activity for a variety of nitrogen heterocycles substituted with diarylmethane or diarylmethanol groups. J Med Chem33:416-29 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 19A1
Name:Cytochrome P450 19A1
Synonyms:Aromatase | CYPXIX | Estrogen synthetase | P-450AROM
Type:PROTEIN
Mol. Mass.:58418.09
Organism:Rattus norvegicus
Description:ChEMBL_51211
Residue:508
Sequence:
MFLEMLNPMHYNVTIMVPETVPVSAMPLLLIMGLLLLIRNCESSSSIPGPGYCLGIGPLI
SHGRFLWMGIGSACNYYNKMYGEFMRVWISGEETLIISKSSSMVHVMKHSNYISRFGSKR
GLQCIGMHENGIIFNNNPSLWRTVRPFFMKALTGPGLIRMVEVCVESIKQHLDRLGDVTD
NSGYVDVVTLMRHIMLDTSNTLFLGIPLDESSIVKKIQGYFNAWQALLIKPNIFFKISWL
YRKYERSVKDLKDEIEILVEKKRQKVSSAEKLEDCMDFATDLIFAERRGDLTKENVNQCI
LEMLIAAPDTMSVTLYVMLLLIAEYPEVETAILKEIHTVVGDRDIRIGDVQNLKVVENFI
NESLRYQPVVDLVMRRALEDDVIDGYPVKKGTNIILNIGRMHRLEYFPKPNEFTLENFEK
NVPYRYFQPFGFGPRSCAGKYIAMVMMKVVLVTLLKRFHVKTLQKRCIENMPKNNDLSLH
LDEDSPIVEIIFRHIFNTPFLQCLYISL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014324
NameBDBM50014324
Synonyms:5-[Bis-(4-chloro-phenyl)-methyl]-pyrimidine | 5-[Bis-(4-chloro-phenyl)-methyl]-pyrimidine(LY56110) | CHEMBL29669 | LY-56110
TypeSmall organic molecule
Emp. Form.C17H12Cl2N2
Mol. Mass.315.197
SMILESClc1ccc(cc1)C(c1ccc(Cl)cc1)c1cncnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a