Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 19A1
LigandBDBM50014320
Substrate/Competitorn/a
Meas. Tech.ChEBML_51211
Ki 24±n/a nM
Citation Cole, PARobinson, CH Mechanism and inhibition of cytochrome P-450 aromatase. J Med Chem33:2933-42 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 19A1
Name:Cytochrome P450 19A1
Synonyms:Aromatase | CYPXIX | Estrogen synthetase | P-450AROM
Type:PROTEIN
Mol. Mass.:58418.09
Organism:Rattus norvegicus
Description:ChEMBL_51211
Residue:508
Sequence:
MFLEMLNPMHYNVTIMVPETVPVSAMPLLLIMGLLLLIRNCESSSSIPGPGYCLGIGPLI
SHGRFLWMGIGSACNYYNKMYGEFMRVWISGEETLIISKSSSMVHVMKHSNYISRFGSKR
GLQCIGMHENGIIFNNNPSLWRTVRPFFMKALTGPGLIRMVEVCVESIKQHLDRLGDVTD
NSGYVDVVTLMRHIMLDTSNTLFLGIPLDESSIVKKIQGYFNAWQALLIKPNIFFKISWL
YRKYERSVKDLKDEIEILVEKKRQKVSSAEKLEDCMDFATDLIFAERRGDLTKENVNQCI
LEMLIAAPDTMSVTLYVMLLLIAEYPEVETAILKEIHTVVGDRDIRIGDVQNLKVVENFI
NESLRYQPVVDLVMRRALEDDVIDGYPVKKGTNIILNIGRMHRLEYFPKPNEFTLENFEK
NVPYRYFQPFGFGPRSCAGKYIAMVMMKVVLVTLLKRFHVKTLQKRCIENMPKNNDLSLH
LDEDSPIVEIIFRHIFNTPFLQCLYISL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014320
NameBDBM50014320
Synonyms:8-Chloro-5-(4-chloro-phenyl)-5H-indeno[1,2-d]pyrimidine(LY 113174) | CHEMBL101324 | LY-113174
TypeSmall organic molecule
Emp. Form.C17H10Cl2N2
Mol. Mass.313.181
SMILESClc1ccc(cc1)C1c2ccc(Cl)cc2-c2ncncc12
Structure
n/a