Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM81925
Substrate/Competitorn/a
Meas. Tech.ChEBML_29453
Ki 0.460000±n/a nM
Citation Peet, NPLentz, NLMeng, ECDudley, MWOgden, AMDemeter, DAWeintraub, HJBey, P A novel synthesis of xanthines: support for a new binding mode for xanthines with respect to adenosine at adenosine receptors. J Med Chem33:3127-30 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptors A1
Type:Protein
Mol. Mass.:36704.13
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:326
Sequence:
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81925
NameBDBM81925
Synonyms:8-Cyclopentyl-1,3-dimethyl-3,7-dihydro-purine-2,6-dione | 8-Cyclopentyltheophylline (CPT) | CAS_1917 | CHEMBL106265 | CPT | NSC_1917
TypeSmall organic molecule
Emp. Form.C12H16N4O2
Mol. Mass.248.281
SMILESCn1c2nc([nH]c2c(=O)n(C)c1=O)C1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a