Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAtrial natriuretic peptide receptor B
LigandBDBM50013335
Substrate/Competitorn/a
Meas. Tech.ChEMBL_35003
IC50 3.6±n/a nM
Citation DiMaio, JJaramillo, JWernic, DGrenier, LWelchner, EAdams, J Synthesis and biological activity of atrial natriuretic factor analogues: effect of modifications to the disulfide bridge. J Med Chem33:661-7 (1990) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Atrial natriuretic peptide receptor B
Name:Atrial natriuretic peptide receptor B
Synonyms:ANP-B | ANPRB | Atrial natriuretic peptide B-type receptor | GC-B | Guanylate cyclase B | NPR-B
Type:PROTEIN
Mol. Mass.:117152.29
Organism:Bos taurus
Description:ChEMBL_35003
Residue:1047
Sequence:
MALPSLLLVVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAMEALGRAL
PVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLL
TAGAVASGFSAKSEHYRTLVRTGPSAPKLGEFVVMLHGHFNWTARAALLYLDARTDDRPH
YFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQA
QRENLTNGDYVFFYLDVFGESLRAGPTRSMGRPWQDNRTREQAQALREAFQTVLVITYRE
PPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAEVLNETIQEGGTRED
GLRIVEKMQGRRYRGVTGLVVMDKNNDRETDFVLWAMGDLVSGDFQPAAHYSGAEKQIWW
TGRPIPWVKGVPPLDNPPCAFDMDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRK
LMLEKELASMLWRIRWEELQFGNSERCHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANT
GHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCP
RGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIIASHGSLKSSNCVVDSRFVLKI
TDYGLASFRSTAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALR
SGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDPAERPDFG
QIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPH
SVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNF
DVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGV
HTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELR
GDVEMKGKGKMRTYWLLGERKGPAGLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50013335
n/a
NameBDBM50013335
Synonyms:CHEMBL440816 | r-ANF (105-126)(Atrial Natriuretic Factor)
TypeSmall organic molecule
Emp. Form.C101H155N33O30S2
Mol. Mass.2375.645
SMILESCC[C@H](C)[C@@H]1NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)CNC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](N)CSSC[C@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)CNC1=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(O)=O)[C@@H](C)CC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: