Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50005703
Substrate/Competitorn/a
Meas. Tech.ChEMBL_160731
IC50>100±n/a nM
Citation Krohn, ARedshaw, SRitchie, JCGraves, BJHatada, MH Novel binding mode of highly potent HIV-proteinase inhibitors incorporating the (R)-hydroxyethylamine isostere. J Med Chem34:3340-2 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005703
NameBDBM50005703
Synonyms:2-[2-({1-[3-(2-Benzyloxycarbonylamino-3-carbamoyl-propionylamino)-2-hydroxy-4-phenyl-butyl]-pyrrolidine-2-carbonyl}-amino)-3-methyl-pentanoylamino]-3-methyl-butyric acid methyl ester | BDBM50010491 | CHEMBL111958 | CHEMBL281158
TypeSmall organic molecule
Emp. Form.C39H56N6O9
Mol. Mass.752.8967
SMILESCC[C@H](C)[C@H](NC(=O)[C@@H]1CCCN1C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)OCc1ccccc1)C(=O)N[C@@H](C(C)C)C(=O)OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a