Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSLC6A3
LigandBDBM50011396
Substrate/Competitorn/a
Meas. Tech.ChEBML_49348
IC50 1090±n/a nM
Citation Kline, RHWright, JEshleman, AJFox, KMEldefrawi, ME Synthesis of 3-carbamoylecgonine methyl ester analogues as inhibitors of cocaine binding and dopamine uptake. J Med Chem34:702-5 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
SLC6A3
Name:Dopamine transporter
Synonyms:Sodium-dependent dopamine transporter
Type:Enzyme Catalytic Domain
Mol. Mass.:75707.43
Organism:BOVINE
Description:Dopamine Transporter SLC6A3 BOVINE::P27922
Residue:693
Sequence:
MSEGRCSVAHMSSVVAPAKEANAMGPKAVELVLVKEQNGVQLTNSTLLNPPQSPTEAQDR
ETWSKKADFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLFFMVVAGVPLFYMELAL
GQFNREGAAGVWKICPILRGVGYTAILISLYIGFFYNVIIAWALHYLLSSFTTELPWTHC
NHSWNSPRCSDARAPNASSGPNGTSRTTPAAEYFERGVLHLHESQGIDDLGPPRWQLTSC
LVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLFALLLRGITLPGAVDAIRAYLSVDFH
RLCEASVWIDAAIQICFSLGVGLGVLIAFSSYNKFTNNCYRDAIITTSVNSLTSFSSGFV
VFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEALATLPLSSVWAVVFFVMLLTLGIDSA
MGGMESVITGLADEFQLLHRHRELFTLLVVLATFLLSLFCVTNGGIYVFTLLDHFAAGTS
ILFGVLMEVIGVAWFYGVWQFSDDIKQMTGRRPSLYWRLCWKFVSPCFLLFVVVVSIATF
RPPHYGAYVFPEWATALGWAIAASSMSVVPIYAAYKLCSLPGSSREKLAYAITPETEHGR
VDSGGGAPVHAPPLARGVGRWRKRKSCWVPSRGPGRGGPPTPSPRLAGHTRAFPWTGAPP
VPRELTPPSTCRCVPPLVCAHPAVESTGLCSVY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011396
NameBDBM50011396
Synonyms:8-Methyl-3-(4-nitro-phenylcarbamoyloxy)-8-aza-bicyclo[3.2.1]octane-2-carboxylic acid methyl ester | CHEMBL163614
TypeSmall organic molecule
Emp. Form.C17H21N3O6
Mol. Mass.363.3651
SMILESCOC(=O)C1C2CC[C@H](C[C@@H]1OC(=O)Nc1ccc(cc1)[N+]([O-])=O)N2C |TLB:25:24:4.10.9:6.7,11:10:24:6.7,THB:2:4:24:6.7|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a