Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOpioid receptors; mu & delta
LigandBDBM50009137
Substrate/Competitorn/a
Meas. Tech.ChEBML_147051
Ki 7.7±n/a nM
Citation Lazarus, LHSalvadori, SSantagada, VTomatis, RWilson, WE Function of negative charge in the"address domain" of deltorphins. J Med Chem34:1350-5 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Opioid receptors; mu & delta
Name:Opioid receptors; mu & delta
Synonyms:Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Voltage-gated potassium channel
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40465.04
Organism:Rattus norvegicus (rat)
Description:Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor.
Residue:372
Sequence:
MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009137
NameBDBM50009137
Synonyms:3-(2-{2-[2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-4-methylsulfanyl-butyrylamino}-3-phenyl-propionylamino)-N-{1-[1-(1-carbamoyl-2-carboxy-ethylcarbamoyl)-3-methylsulfanyl-propylcarbamoyl]-3-methyl-butyl}-succinamic acid | CHEMBL282181
TypeSmall organic molecule
Emp. Form.C42H60N8O12S2
Mol. Mass.933.102
SMILESCSCC[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a