Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysosomal phospholipase A1
LigandBDBM50011902
Substrate/Competitorn/a
Meas. Tech.ChEBML_100183
IC50 83000±n/a nM
Citation Mingeot-Leclercq, MPVan Schepdael, ABrasseur, RBusson, RVanderhaeghe, HJClaes, PJTulkens, PM New derivatives of kanamycin B obtained by modifications and substitutions in position 6''. 2. In vitro and computer-aided toxicological evaluation with respect to interactions with phosphatidylinositol. J Med Chem34:1476-82 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysosomal phospholipase A1
Name:Acyl-protein thioesterase 1/2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:24708.49
Organism:Rattus norvegicus
Description:ChEMBL_100186
Residue:230
Sequence:
MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSSHIKYICPHAPVMP
VTLNMSMMMPSWFDIIGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLM
FGSLTVERLKGLVNPANVTFKVYEGMMHSSCQQEMMDVKYFIDKLLPPID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011902
NameBDBM50011902
Synonyms:5-amino-2-aminomethyl-6-[4,6-diamino-3-(4-amino-6-aminomethyl-3,5-dihydroxytetrahydro-2H-2-pyranyloxy)-2-hydroxycyclohexyloxy]tetrahydro-2H-3,4-pyrandiol | CHEMBL288690
TypeSmall organic molecule
Emp. Form.C18H38N6O9
Mol. Mass.482.5291
SMILESNCC1OC(OC2C(N)CC(N)C(OC3OC(CN)C(O)C(O)C3N)C2O)C(O)C(N)C1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a