Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysosomal phospholipase A1
LigandBDBM50011926
Substrate/Competitorn/a
Meas. Tech.ChEBML_100186
IC50 79000±n/a nM
Citation Van Schepdael, ABusson, RVanderhaeghe, HJClaes, PJVerbist, LMingeot-Leclercq, MPBrasseur, RTulkens, PM New derivatives of kanamycin B obtained by combined modifications in positions 1 and 6". Synthesis, microbiological properties, and in vitro and computer-aided toxicological evaluation. J Med Chem34:1483-92 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysosomal phospholipase A1
Name:Acyl-protein thioesterase 1/2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:24708.49
Organism:Rattus norvegicus
Description:ChEMBL_100186
Residue:230
Sequence:
MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSSHIKYICPHAPVMP
VTLNMSMMMPSWFDIIGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLM
FGSLTVERLKGLVNPANVTFKVYEGMMHSSCQQEMMDVKYFIDKLLPPID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011926
NameBDBM50011926
Synonyms:4-amino-2-[2,4-diamino-5-(3-amino-6-aminomethyl-4,5-dihydroxytetrahydro-2H-2-pyranyloxy)-6-hydroxy-2-hydroxymethylcyclohexyloxy]-6-hydroxymethyltetrahydro-2H-3,5-pyrandiol | CHEMBL38377
TypeSmall organic molecule
Emp. Form.C19H39N5O11
Mol. Mass.513.5399
SMILESNCC1OC(OC2C(N)CC(N)(CO)C(OC3OC(CO)C(O)C(N)C3O)C2O)C(N)C(O)C1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a