Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetmu/kappa opioid receptor
LigandBDBM50453051
Substrate/Competitorn/a
Meas. Tech.ChEMBL_147104
IC50 166000±n/a nM
Citation Hruby, VJToth, GGehrig, CAKao, LFKnapp, RLui, GKYamamura, HIKramer, THDavis, PBurks, TF Topographically designed analogues of [D-Pen,D-Pen5]enkephalin. J Med Chem34:1823-30 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
mu/kappa opioid receptor
Name:mu/kappa opioid receptor
Synonyms:Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:OPIATE Mu OPRM1 GUINEA PIG::P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50453051
NameBDBM50453051
Synonyms:CHEMBL2115465
TypeSmall organic molecule
Emp. Form.C31H41N5O7S2
Mol. Mass.659.817
SMILES[H][C@@]1(NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](N)Cc2ccc(O)cc2)C(C)(C)SSC(C)(C)[C@H](NC1=O)C(O)=O)[C@@H](C)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a