Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThermolysin
LigandBDBM50006110
Substrate/Competitorn/a
Meas. Tech.ChEBML_210389
Ki 9.1±n/a nM
Citation Bohacek, RSMcMartin, C Definition and display of steric, hydrophobic, and hydrogen-bonding properties of ligand binding sites in proteins using Lee and Richards accessible surface: validation of a high-resolution graphical tool for drug design. J Med Chem35:1671-84 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thermolysin
Name:Thermolysin
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:60097.54
Organism:Bacillus thermoproteolyticus
Description:ChEMBL_1468794
Residue:548
Sequence:
MKMKMKLASFGLAAGLAAQVFLPYNALASTEHVTWNQQFQTPQFISGDLLKVNGTSPEEL
VYQYVEKNENKFKFHENAKDTLQLKEKKNDNLGFTFMRFQQTYKGIPVFGAVVTSHVKDG
TLTALSGTLIPNLDTKGSLKSGKKLSEKQARDIAEKDLVANVTKEVPEYEQGKDTEFVVY
VNGDEASLAYVVNLNFLTPEPGNWLYIIDAVDGKILNKFNQLDAAKPGDVKSITGTSTVG
VGRGVLGDQKNINTTYSTYYYLQDNTRGNGIFTYDAKYRTTLPGSLWADADNQFFASYDA
PAVDAHYYAGVTYDYYKNVHNRLSYDGNNAAIRSSVHYSQGYNNAFWNGSQMVYGDGDGQ
TFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEI
GEDVYTPGISGDSLRSMSDPAKYGDPDHYSKRYTGTQDNGGVHINSGIINKAAYLISQGG
THYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQ
AFDAVGVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50006110
NameBDBM50006110
Synonyms:(ZGPLA) 2-[2-(2-Benzyloxycarbonylamino-acetylamino)-4-methyl-pentanoylamino]-4-methyl-pentanoic acid | CHEMBL416089
TypeSmall organic molecule
Emp. Form.C22H34N3O9P
Mol. Mass.515.4938
SMILESCC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)CN(C(=O)OCc1ccccc1)P(O)(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a