Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-gated L-type calcium channel alpha-1C subunit
LigandBDBM50002628
Substrate/Competitorn/a
Meas. Tech.ChEBML_164619
IC50 2.9±n/a nM
Citation Sunkel, CEFau de Casa-Juana, MSantos, LGarcía, AGArtalejo, CRVillarroya, MGonzález-Morales, MALópez, MGCillero, JAlonso, S Synthesis of 3-[(2,3-dihydro-1,1,3-trioxo-1,2-benzisothiazol-2-yl)alkyl] 1,4-dihydropyridine-3,5-dicarboxylate derivatives as calcium channel modulators. J Med Chem35:2407-14 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Voltage-gated L-type calcium channel alpha-1C subunit
Name:L-type calcium channel alpha 1C/beta 2A
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:242793.78
Organism:Oryctolagus cuniculus
Description:ChEMBL_42776
Residue:2171
Sequence:
MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPGGSNYGSPRPAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGVADVPAEDDPSPCALETGHGRQCQNGT
VCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVI
FGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN
RFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAE
MLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKVMSPLGISVLRCVRLLRIFKI
TRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFD
NFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVVGKPALEEAKEEKIELKSIT
ADGESPPTTKINMDDLQPNESEDKSPYPNPETTGEEDEEEPEMPVGPRPRPLSELHLKEK
AVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRN
HILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSA
INVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQL
FKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFT
VSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQ
EQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLIL
LNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLI
VIGSIIDVILSETNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLL
WTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLF
RCATGEAWQDIMLACMPGKKCAPESEPHNSTEGETPCGSSFAVFYFISFYMLCAFLIINL
FVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGF
GKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIK
KIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALS
LQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYY
QSDSRSAFPQTFTTQRPLHISKAGNNQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNA
NNTALGRLPRPAGYPSTVSTVEGHGSPLSPAVRAQEAAWKLSSKRCHSQESQIAMACQEG
ASQDDNYDVRIGEDAECCSEPSLLSTEMLSYQDDENRQLAPPEEEKRDIRLSPKKGFLRS
ASLGRRASFHLECLKRQKNQGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTSLPR
PCATPPATPGSRGWPPQPIPTLRLEGADSSEKLNSSFPSIHCGSWSGENSPCRGDSSAAR
RARPVSLTVPSQAGAQGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDL
TIEEMENAADDILSGGARQSPNGTLLPFVNRRDPGRDRAGQNEQDASGACAPGCGQSEEA
LADRRAGVSSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002628
NameBDBM50002628
Synonyms:4-(2,3-Dichloro-phenyl)-2,6-dimethyl-1,4-dihydro-pyridine-3,5-dicarboxylic acid 3-(2-methoxy-ethyl) ester 5-(1,1,3-trioxo-1,3-dihydro-1lambda*6*-benzo[d]isothiazol-2-ylmethyl) ester | CHEMBL78651
TypeSmall organic molecule
Emp. Form.C26H24Cl2N2O8S
Mol. Mass.595.448
SMILESCOCCOC(=O)C1C(C(C(=O)OCN2C(=O)c3ccccc3S2(=O)=O)=C(C)N=C1C)c1cccc(Cl)c1Cl |c:30,t:27|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a