Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor
LigandBDBM21173
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29322
Ki 0.490000±n/a nM
Citation Suzuki, FShimada, JMizumoto, HKarasawa, AKubo, KNonaka, HIshii, AKawakita, T Adenosine A1 antagonists. 2. Structure-activity relationships on diuretic activities and protective effects against acute renal failure. J Med Chem35:3066-75 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor
Name:Adenosine receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptors A1
Type:Protein
Mol. Mass.:36704.13
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:326
Sequence:
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21173
NameBDBM21173
Synonyms:1,3-dipropyl-8-cyclopentylxanthine | 8-cyclopentyl-1,3-dipropyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione | CHEMBL183 | DPCPX | PD116948 | [3H]DPCPX
Typeradiolabeled ligand
Emp. Form.C16H24N4O2
Mol. Mass.304.3874
SMILESCCCn1c2nc([nH]c2c(=O)n(CCC)c1=O)C1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a