Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM50003024
Substrate/Competitorn/a
Meas. Tech.ChEBML_29322
Ki 0.990000±n/a nM
Citation Suzuki, FShimada, JMizumoto, HKarasawa, AKubo, KNonaka, HIshii, AKawakita, T Adenosine A1 antagonists. 2. Structure-activity relationships on diuretic activities and protective effects against acute renal failure. J Med Chem35:3066-75 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptors A1
Type:Protein
Mol. Mass.:36704.13
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:326
Sequence:
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003024
NameBDBM50003024
Synonyms:(8-(dicyclopropylmethyl)-1,3-dipropylxanthine)8-Dicyclopropylmethyl-1,3-dipropyl-3,7-dihydro-purine-2,6-dione | 8-Dicyclopropylmethyl-1,3-dipropyl-3,7-dihydro-purine-2,6-dione | CHEMBL84363
TypeSmall organic molecule
Emp. Form.C18H26N4O2
Mol. Mass.330.4246
SMILESCCCn1c2nc([nH]c2c(=O)n(CCC)c1=O)C(C1CC1)C1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a