Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50003558
Substrate/Competitorn/a
Meas. Tech.ChEBML_154975
IC50 51±n/a nM
Citation Carceller, EAlmansa, CMerlos, MGiral, MBartrolí, JGarcía-Rafanell, JForn, J (Pyridylcyanomethyl)piperazines as orally active PAF antagonists. J Med Chem35:4118-34 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF-R | Platelet-activating factor receptor
Type:Protein
Mol. Mass.:39005.63
Organism:Cavia porcellus
Description:n/a
Residue:342
Sequence:
MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003558
NameBDBM50003558
Synonyms:CHEMBL3216867 | CHEMBL555357 | [4-(3,3-Diphenyl-propionyl)-piperazin-1-yl]-pyridin-4-yl-acetonitrile; dihydrochloride
TypeSmall organic molecule
Emp. Form.C26H28Cl2N4O
Mol. Mass.483.433
SMILESCl.Cl.O=C(CC(c1ccccc1)c1ccccc1)N1CCN(CC1)C(C#N)c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a