Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine deaminase
LigandBDBM22925
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30785
Ki 0.002500±n/a nM
Citation Harriman, GCPoirot, AFAbushanab, EMidgett, RMStoeckler, JD Adenosine deaminase inhibitors. Synthesis and biological evaluation of C1' and nor-C1' derivatives of (+)-erythro-9-(2(S)-hydroxy-3(R)-nonyl)adenine. J Med Chem35:4180-4 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine deaminase
Name:Adenosine deaminase
Synonyms:ADA | Adenosine aminohydrolase
Type:Enzyme
Mol. Mass.:40910.44
Organism:Bos taurus (bovine)
Description:n/a
Residue:363
Sequence:
MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPE
FLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQA
EGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAI
DLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGY
HTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIF
KSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAE
QCL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22925
NameBDBM22925
Synonyms:(8R)-3-[(2R,4S,5R)-4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]-3H,6H,7H,8H-imidazo[4,5-d][1,3]diazepin-8-ol | Covidarabine | Deoxycoformycin | Nipent | Pentostatin
TypeNucleoside or nucleotide
Emp. Form.C11H16N4O4
Mol. Mass.268.2691
SMILESOC[C@H]1O[C@H](C[C@@H]1O)n1cnc2[C@H](O)CNC=Nc12 |c:17|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a