Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II AT1B
LigandBDBM50406795
Substrate/Competitorn/a
Meas. Tech.ChEMBL_217980
Ki 9±n/a nM
Citation Atwal, KSAhmed, SZBird, JEDelaney, CLDickinson, KEFerrara, FNHedberg, AMiller, AVMoreland, SO'Reilly, BC Dihydropyrimidine angiotensin II receptor antagonists. J Med Chem35:4751-63 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II AT1B
Name:Angiotensin II receptor (AT-1) type-1
Synonyms:AT1B | AT3 | Angiotensin II receptor (AT-1) type-1 | Angiotensin II type 1b (AT-1b) receptor | Type-1B angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:40929.44
Organism:RAT
Description:Angiotensin II AT1B 0 RAT::P29089
Residue:359
Sequence:
MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50406795
NameBDBM50406795
Synonyms:Cozaar | LOSARTAN POTASSIUM
TypeSmall organic molecule
Emp. Form.C22H22ClN6O
Mol. Mass.421.903
SMILESCCCCc1nc(Cl)c(CO)n1Cc1ccc(cc1)-c1ccccc1-c1nn[n-]n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a