Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAminopeptidase B
LigandBDBM50001951
Substrate/Competitorn/a
Meas. Tech.ChEMBL_35342
IC50 982000±n/a nM
Citation Herranz, RVinuesa, SPérez, CGarcía-López, MTLópez, Ede Ceballos, MLDel Río, J Analgesic dipeptide derivatives. 7. 3,7-Diamino-2-hydroxyheptanoic acid (DAHHA) containing dipeptide analogues of the analgesic compound H-Lys-Trp(Nps)-OMe. J Med Chem35:889-95 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aminopeptidase B
Name:Aminopeptidase B
Synonyms:Ap-B | Arginine aminopeptidase | Arginyl aminopeptidase | Cytosol aminopeptidase IV
Type:PROTEIN
Mol. Mass.:72609.93
Organism:Rattus norvegicus
Description:ChEMBL_1344423
Residue:650
Sequence:
MESSGPSSCHSAARRPLHSAQAVDVASASSFRAFEILHLHLDLRAEFGPPGPGPGSRGLN
GKATLELRCLLPEGASELRLDSHSCLEVMAATLLRGQPGDQQQLTEPVPFHTQPFSHYGQ
ALCVVFPKPCCAAERFRLELTYRVGEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFP
CFDTPAVKCTYSALVEVPDGFTAVMSASTWERRGPNKFFFQMSQPIPSYLIALAIGDLAS
AEVGPRSRVWAEPCLIEAAKEEYNGVIEEFLATGEKLFGPYVWGRYDLLFMPPSFPFGGM
ENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRIST
ILFGAAYTCLEAATGRALLRQHMDVSGEENPLNKLRVKIEPGVDPDDTYNETPYEKGYCF
VSYLAHLVGDQEQFDKFLKAYVDEFKFQSILAEDFLEFYLEYFPELKKKGVDSIPGFEFN
RWLNTPGWPPYLPDLSPGDSLMKPAEELAELWAASEPDMQAIEAVAISTWKTYQLVYFLD
KILQKSPLPPGNVKKLGETYPKISNAQNAELRLRWGQIILKNDHQEEFWKVKDFLQSQGK
QKYTLPLYHAMMGGSEMARTLAKETFSATASQLHSNVVNYVQQILAPKGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001951
NameBDBM50001951
Synonyms:2-(3,7-Diamino-2-hydroxy-heptanoylamino)-3-[2-(2-nitro-phenylsulfanyl)-1H-indol-3-yl]-propionic acid methyl ester | CHEMBL170314
TypeSmall organic molecule
Emp. Form.C25H31N5O6S
Mol. Mass.529.609
SMILESCOC(=O)[C@@H](Cc1c(Sc2ccccc2[N+]([O-])=O)[nH]c2ccccc12)NC(=O)[C@H](O)[C@@H](N)CCCCN
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a