Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAminopeptidase N
LigandBDBM50001949
Substrate/Competitorn/a
Meas. Tech.ChEMBL_35368
IC50 261000±n/a nM
Citation Herranz, RVinuesa, SPérez, CGarcía-López, MTLópez, Ede Ceballos, MLDel Río, J Analgesic dipeptide derivatives. 7. 3,7-Diamino-2-hydroxyheptanoic acid (DAHHA) containing dipeptide analogues of the analgesic compound H-Lys-Trp(Nps)-OMe. J Med Chem35:889-95 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aminopeptidase N
Name:Aminopeptidase N
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:109431.53
Organism:Rattus norvegicus
Description:ChEMBL_35366
Residue:965
Sequence:
MAKGFYISKTLGILGILLGVAAVCTIIALSVVYAQEKNRNAENSAIAPTLPGSTSATTST
TNPAIDESKPWNQYRLPKTLIPDSYQVTLRPYLTPNEQGLYIFKGSSTVRFTCNETTNVI
IIHSKKLNYTNKGNHRVALRALGDTPAPNIDTTELVERTEYLVVHLQGSLVKGHQYEMDS
EFQGELADDLAGFYRSEYMEGGNKKVVATTQMQAADARKSFPCFDEPAMKASFNITLIHP
NNLTALSNMLPKDSRTLQEDPSWNVTEFHPTPKMSTYLLAYIVSEFKYVEAVSPNRVQIR
IWARPSAIDEGHGDYALQVTGPILNFFAQHYNTAYPLEKSDQIALPDFNAGAMENWGLVT
YRESALVFDPQSSSISNKERVVTVIAHELAHQWFGNLVTVDWWNDLWLNEGFASYVEFLG
ADYAEPTWNLKDLIVLNDVYRVMAVDALASSHPLSSPANEVNTPAQISELFDSITYSKGA
SVLRMLSSFLTEDLFKKGLSSYLHTFQYSNTIYLDLWEHLQQAVDSQTAIKLPASVSTIM
DRWILQMGFPVITVNTSTGEIYQEHFLLDPTSKPTRPSDFNYLWIVPIPYLKNGKEDHYW
LETEKNQSAEFQTSSNEWLLLNINVTGYYQVNYDENNWRKIQNQLQTDLSVIPVINRAQI
IHDSFNLASAGKLSITLPLSNTLFLASETEYMPWEAALSSLNYFKLMFDRSEVYGPMKRY
LKKQVTPLFAYFKIKTNNWLDRPPTLMEQYNEINAISTACSSGLEECRDLVVGLYSQWMN
NSDNNPIHPNLRSTVYCNAIAFGGEEEWNFAWEQFRKATLVNEADKLRSALACSNEVWIL
NRYLSYTLNPDYIRKQDATSTIVSIANNVVGQTLVWDFVRSNWKKLFEDYGGGSFSFANL
IQGVTRRFSSEFELQQLEQFKEDNSATGFGSGTRALEQALEKTKANIKWVKENKDVVLKW
FTENS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001949
NameBDBM50001949
Synonyms:2-(2,6-Diamino-hexanoylamino)-3-[2-(2-nitro-phenylsulfanyl)-1H-indol-3-yl]-propionic acid methyl ester | CHEMBL178014
TypeSmall organic molecule
Emp. Form.C24H29N5O5S
Mol. Mass.499.583
SMILESCOC(=O)[C@H](Cc1c(Sc2ccccc2[N+]([O-])=O)[nH]c2ccccc12)NC(=O)[C@@H](N)CCCCN
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a