Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRB2
LigandBDBM50000496
Substrate/Competitorn/a
Meas. Tech.ChEMBL_37817
Ki>100000±n/a nM
Citation Macchia, BBalsamo, ABreschi, MCLapucci, ALucacchini, AMacchia, FManera, CMartinelli, AMartini, CMartinotti, E Conformational effects on the activity of drugs. 13. A revision of previously proposed models for the activation of alpha- and beta-adrenergic receptors. J Med Chem35:1009-18 (1992) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
ADRB2
Name:ADRB2
Synonyms:Beta-2 adrenoceptor | Beta-2 adrenoreceptor | adrenergic Beta
Type:Enzyme Catalytic Domain
Mol. Mass.:47141.18
Organism:BOVINE
Description:adrenergic Beta ADRB2 BOVINE::Q28044
Residue:418
Sequence:
MGQPGNRSVFLLAPNASHAPDQNVTLERDEAWVVGMGILMSLIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGACHILMKMWTFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYLAITSPFKYQCLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRASHKE
AINCYAKETCCDFFTNQPYAIASSIVSFYLPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF
HAQNVSQVEQDGRSGLGQRRTSKFYLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIKD
NLIRKEIYILLNWLGYINSAFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGCSSNSND
RTDYTGEQSGYHLGEEKDSELLCEDPPGTENFVNQQGTVPSDSIDSQGRNCSTNDSLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50000496
n/a
NameBDBM50000496
Synonyms:4-(3-Hydroxy-piperidin-3-yl)-benzene-1,2-diol | CHEMBL7278
TypeSmall organic molecule
Emp. Form.C11H15NO3
Mol. Mass.209.2417
SMILESOc1ccc(cc1O)C1(O)CCCNC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: