Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(2) dopamine receptor
LigandBDBM50001958
Substrate/Competitorn/a
Meas. Tech.ChEMBL_62419
Ki>1000±n/a nM
Citation Moon, MWMorris, JKHeier, RFChidester, CGHoffmann, WEPiercey, MFAlthaus, JSVon Voigtlander, PFEvans, DLFigur, LM Dopaminergic and serotonergic activities of imidazoquinolinones and related compounds. J Med Chem35:1076-92 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(2) dopamine receptor
Name:D(2) dopamine receptor
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DRD2 | Dopamine D2 receptor | Dopamine2-like
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:50931.60
Organism:Rattus norvegicus (rat)
Description:P61169
Residue:444
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001958
NameBDBM50001958
Synonyms:(2-Methylsulfanyl-5,6-dihydro-4H-imidazo[4,5,1-ij]quinolin-5-yl)-dipropyl-amine | CHEMBL267107
TypeSmall organic molecule
Emp. Form.C17H25N3S
Mol. Mass.303.465
SMILESCCCN(CCC)C1Cc2cccc3nc(SC)n(C1)c23
Structure
n/a