Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine Transporter (DAT)
LigandBDBM50453093
Substrate/Competitorn/a
Meas. Tech.ChEBML_62171
IC50 8±n/a nM
Citation Carroll, FILewin, AHBoja, JWKuhar, MJ Cocaine receptor: biochemical characterization and structure-activity relationships of cocaine analogues at the dopamine transporter. J Med Chem35:969-81 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dopamine Transporter (DAT)
Name:Monoamine transporters; Norepininephrine & dopamine
Synonyms:DA transporter | Sodium-dependent dopamine transporter | Sodium-dependent dopamine transporter (DAT)
Type:Multi-pass membrane protein
Mol. Mass.:68749.45
Organism:Rattus norvegicus (rat)
Description:Rat caudate membranes were used as DAT source in binding assay.
Residue:619
Sequence:
MSKSKCSVGPMSSVVAPAKESNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEAQER
ETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHC
NNTWNSPNCSDAHASNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLT
ACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAMDGIRAYLSVD
FYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFSSG
FVVFSFLGYMAQKHNVPIRDVATDGPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGID
SAMGGMESVITGLVDEFQLLHRHRELFTLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAG
TSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRPNLYWRLCWKLVSPCFLLYVVVVSIV
TFRPPHYGAYIFPDWANALGWIIATSSMAMVPIYATYKFCSLPGSFREKLAYAITPEKDH
QLVDRGEVRQFTLRHWLLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50453093
NameBDBM50453093
Synonyms:CHEMBL2373744
TypeSmall organic molecule
Emp. Form.C17H23NO3
Mol. Mass.289.3694
SMILES[H][C@@]12CCC([C@H]([C@H](C1)c1ccc(OC)cc1)C(=O)OC)N2C |r,TLB:21:20:3.2:7.6.5,8:6:3.2:20,THB:16:5:3.2:20|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a