Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine Transporter (DAT)
LigandBDBM50005561
Substrate/Competitorn/a
Meas. Tech.ChEBML_62171
IC50 257±n/a nM
Citation Carroll, FILewin, AHBoja, JWKuhar, MJ Cocaine receptor: biochemical characterization and structure-activity relationships of cocaine analogues at the dopamine transporter. J Med Chem35:969-81 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dopamine Transporter (DAT)
Name:Monoamine transporters; Norepininephrine & dopamine
Synonyms:DA transporter | Sodium-dependent dopamine transporter | Sodium-dependent dopamine transporter (DAT)
Type:Multi-pass membrane protein
Mol. Mass.:68749.45
Organism:Rattus norvegicus (rat)
Description:Rat caudate membranes were used as DAT source in binding assay.
Residue:619
Sequence:
MSKSKCSVGPMSSVVAPAKESNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEAQER
ETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHC
NNTWNSPNCSDAHASNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLT
ACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAMDGIRAYLSVD
FYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFSSG
FVVFSFLGYMAQKHNVPIRDVATDGPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGID
SAMGGMESVITGLVDEFQLLHRHRELFTLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAG
TSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRPNLYWRLCWKLVSPCFLLYVVVVSIV
TFRPPHYGAYIFPDWANALGWIIATSSMAMVPIYATYKFCSLPGSFREKLAYAITPEKDH
QLVDRGEVRQFTLRHWLLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005561
NameBDBM50005561
Synonyms:3-Benzoyloxy-8-methyl-8-aza-bicyclo[3.2.1]octane-2-carboxylic acid benzyl ester | CHEMBL176723
TypeSmall organic molecule
Emp. Form.C23H25NO4
Mol. Mass.379.4489
SMILESCN1[C@@H]2CCC1C([C@H](C2)OC(=O)c1ccccc1)C(=O)OCc1ccccc1 |TLB:0:1:6.7.8:4.3|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a