Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50005889
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63978
Ki 7500±n/a nM
Citation Zembower, DEKam, CMPowers, JCZalkow, LH Novel anthraquinone inhibitors of human leukocyte elastase and cathepsin G. J Med Chem35:1597-605 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005889
NameBDBM50005889
Synonyms:CHEMBL40878 | Carbonic acid 8-butoxycarbonyloxy-9,10-dioxo-9,10-dihydro-anthracen-1-yl ester butyl ester
TypeSmall organic molecule
Emp. Form.C24H24O8
Mol. Mass.440.4426
SMILESCCCCOC(=O)Oc1cccc2C(=O)c3cccc(OC(=O)OCCCC)c3C(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a