Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin G
LigandBDBM50005892
Substrate/Competitorn/a
Meas. Tech.ChEBML_45341
IC50>60000±n/a nM
Citation Zembower, DEKam, CMPowers, JCZalkow, LH Novel anthraquinone inhibitors of human leukocyte elastase and cathepsin G. J Med Chem35:1597-605 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin G
Name:Cathepsin G
Synonyms:CG
Type:PROTEIN
Mol. Mass.:28860.08
Organism:Homo sapiens (Human)
Description:ChEMBL_1469016
Residue:255
Sequence:
MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVL
TAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRR
NRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYD
PRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRT
TMRSFKLLDQMETPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005892
NameBDBM50005892
Synonyms:1-Hydroxy-8-methoxy-2-propyl-anthraquinone | CHEMBL289034
TypeSmall organic molecule
Emp. Form.C18H16O4
Mol. Mass.296.3172
SMILESCCCc1ccc2C(=O)c3cccc(OC)c3C(=O)c2c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a