Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50038212
Substrate/Competitorn/a
Meas. Tech.ChEBML_140113
Ki 970±n/a nM
Citation Tsukamoto, SIchihara, MWanibuchi, FUsuda, SHidaka, KHarada, MTamura, T Synthesis and structure-activity studies of a series of spirooxazolidine-2,4-diones: 4-oxa analogues of the muscarinic agonist 2-ethyl-8-methyl-2,8-diazaspiro[4.5]decane-1,3-dione. J Med Chem36:2292-9 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic receptor M2 and M3
Synonyms:CHRM2 | Cholinergic, muscarinic M2
Type:Enzyme Catalytic Domain
Mol. Mass.:51555.53
Organism:RAT
Description:P10980
Residue:466
Sequence:
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI
VKPNNNNMPGGDGGLEHNKIQNGKAPRDGVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSRDDNSKQTCIKIVTKAQKGDVCTPTSTTVELVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50038212
NameBDBM50038212
Synonyms:2-Ethyl-8-methyl-2,8-diaza-spiro[4.5]decane-1,3-dione | 2-Ethyl-8-methyl-2,8-diaza-spiro[4.5]decane-1,3-dione (RS-86) | 2-Ethyl-8-methyl-2,8-diaza-spiro[4.5]decane-1,3-dione(RS-86) | CHEMBL273308 | CHEMBL542883
TypeSmall organic molecule
Emp. Form.C11H18N2O2
Mol. Mass.210.2728
SMILESCCN1C(=O)CC2(CCN(C)CC2)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a