Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H2 receptor
LigandBDBM50036754
Substrate/Competitorn/a
Meas. Tech.ChEMBL_85063
IC50 300±n/a nM
Citation Katsura, YInoue, YTomishi, TIshikawa, HTakasugi, H Studies on antiulcer drugs. 7. 2-Guanidino-4-pyridylthiazoles as histamine H2-receptor antagonists with potent gastroprotective effects against nonsteroidal antiinflammatory drug-induced injury. J Med Chem37:57-66 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H2 receptor
Name:Histamine H2 receptor
Synonyms:Gastric receptor I | H2R | HISTAMINE H2 | Histamine H2-Gs alpha S
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40567.22
Organism:Cavia porcellus (domestic guinea pig)
Description:For the H2 receptor-binding assays, guinea pig striatum was used.
Residue:359
Sequence:
MAFNGTVPSFCMDFTVYKVTISVILIILILVTVAGNVVVCLAVGLNRRLRSLTNCFIVSL
AVTDLLLGLLVLPFSAIYQLSCKWSFSKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
TDPLRYPVLITPARVAISLVFIWVISITLSFLSIHLGWNSRNETSKDNDTIVKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYFRIFKIAREQARRINHIGSWKAATIREHKATVTLAAVM
GAFIICWFPYFTVFVYRGLKGDDAVNEVFEDVVLWLGYANSALNPILYAALNRDFRTAYH
QLFCCRLASHNSHETSLRLNNSQLNRSQCQEPRWQEDKPLNLQVWSGTEVTAPQGATNR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50036754
NameBDBM50036754
Synonyms:(1Z)-N'-(aminosulfonyl)-3-[({2-[(diaminomethylene)amino]-1,3-thiazol-4-yl}methyl)thio]propanimidamide | (1Z)-N'-(aminosulfonyl)-3-[({2-[(diaminomethylene)amino]-1,3-thiazol-4-yl}methyl)thio]propanimidamide (Famotidine) | 3-(2-Guanidino-thiazol-4-ylmethylsulfanyl)-N-sulfonylamino-propionamidine | CHEMBL902 | FAMOTIDINE | Fluxid | MK-208 | N'-(aminosulfonyl)-3-(((2-((diaminomethylene)amino)-4-thiazolyl)methyl)thio)propanimidamide | N-sulfomoyl-3-(2-Guanidino-2H-1lambda*4*-thiazol-4-ylmethylsulfanyl)-propionamidine | Pepcid | Pepcid ac | Pepcid ac (geltab) | Pepcid rpd
TypeSmall organic molecule
Emp. Form.C8H15N7O2S3
Mol. Mass.337.445
SMILES[#7]\[#6](-[#7])=[#7]/c1nc(-[#6]-[#16]-[#6]-[#6]-[#6](=[#7])-[#7]S([#7])(=O)=O)cs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a