Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetadrenergic Alpha2
LigandBDBM50036857
Substrate/Competitorn/a
Meas. Tech.ChEMBL_33026
IC50 100±n/a nM
Citation Podona, TGuardiola-Lemaître, BCaignard, DHAdam, GPfeiffer, BRenard, PGuillaumet, G 3,4-Dihydro-3-amino-2H-1-benzopyran derivatives as 5-HT1A receptor ligands and potential anxiolytic agents. 1. Synthesis and structure--activity relationship studies. J Med Chem37:1779-93 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
adrenergic Alpha2
Name:Cerebral cortex alpha adrenergic receptor
Synonyms:Alpha-2A adrenergic receptor | Alpha-2A adrenoceptor | Alpha-2A adrenoreceptor | Alpha-2AAR | Alpha-2D adrenergic receptor | Alpha-2Da adrenergic receptor | Cerebral cortex alpha adrenergic receptor | adrenergic Alpha2A | adrenergic Alpha2D
Type:Enzyme Catalytic Domain
Mol. Mass.:49275.13
Organism:BOVINE
Description:adrenergic Alpha2 0 BOVINE::Q28838
Residue:452
Sequence:
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISFEKKRGRSG
QPSAEPRCEINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDATA
AELPGSAERRPNGLGPERGGVGPVGAEVESLQVQLNGAPGEPAPAGAGADALDLEESSSS
EHAERPPGSRRSERGPRAKGKARASQVKPGDSLPRRGPGATGLGAPTAGPAEERSGGGAK
ASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAIGCPVPPTLFKFFFWFGYCN
SSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50036857
NameBDBM50036857
Synonyms:2-Methoxy-N-{4-[(5-methoxy-chroman-3-yl)-propyl-amino]-butyl}-benzamide; compound with oxalic acid | CHEMBL48925
TypeSmall organic molecule
Emp. Form.C25H34N2O4
Mol. Mass.426.5485
SMILESCCCN(CCCCNC(=O)c1ccccc1OC)C1COc2cccc(OC)c2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a