Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin A receptor
LigandBDBM50044033
Substrate/Competitorn/a
Meas. Tech.ChEMBL_49581
IC50 1.3±n/a nM
Citation Elliott, RLKopecka, HBennett, MJShue, YKCraig, RLin, CWBianchi, BRMiller, TRWitte, DGStashko, MA Tetrapeptide CCK agonists: structure-activity studies on modifications at the N-terminus. J Med Chem37:309-13 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cholecystokinin A receptor
Name:Cholecystokinin A receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:48229.77
Organism:Cavia porcellus
Description:n/a
Residue:430
Sequence:
MDVVDSLFVNGSNITSACELGFENETLFCLDRPRPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPSLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTGNMCRFLLPNDVMQQTWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFDAIQKKSAKERKTSTGSSGPMEDSDGCYLQKSRHPRKLELRQLSPSSSGSNRINRIRS
SSSTANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAERHLSGTPISFILLL
SYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGTPGVRGEMGEEEEGRTTGASLSRYSY
SHMSTSAPPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50044033
NameBDBM50044033
Synonyms:(S)-3-[(S)-2-((S)-2-Benzoylamino-3-1H-indol-3-yl-propionylamino)-6-(3-o-tolyl-ureido)-hexanoylamino]-N-((S)-1-carbamoyl-2-phenyl-ethyl)-N-methyl-succinamic acid | CHEMBL428103
TypeSmall organic molecule
Emp. Form.C46H52N8O8
Mol. Mass.844.9539
SMILESCN([C@@H](Cc1ccccc1)C(N)=O)C(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCNC(=O)Nc1ccccc1C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a