Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D2 receptor/Serotonin 2 (5-HT2) receptor
LigandBDBM50029257
Substrate/Competitorn/a
Meas. Tech.ChEMBL_62394
Ki 2.2±n/a nM
Citation Scott, MKBaxter, EWBennett, DJBoyd, REBlum, PSCodd, EEKukla, MJMalloy, EMaryanoff, BEMaryanoff, CA Piperazinylalkyl heterocycles as potential antipsychotic agents. J Med Chem38:4198-210 (1995) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
Name:Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DOPAMINE D2/D4 | DRD2 | Dopamine D2 receptor | Dopamine2-like
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:50931.60
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat striatal membranes.
Residue:444
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029257
NameBDBM50029257
Synonyms:(3-((4-(2-isopropoxyphenyl)piperazin-1-yl)methyl)phenyl)(piperidin-1-yl)methanone | CHEMBL10085 | RWJ-377796 | mazapertine | {3-[4-(2-Isopropoxy-phenyl)-piperazin-1-ylmethyl]-phenyl}-piperidin-1-yl-methanone
TypeSmall organic molecule
Emp. Form.C26H35N3O2
Mol. Mass.421.575
SMILESCC(C)Oc1ccccc1N1CCN(Cc2cccc(c2)C(=O)N2CCCCC2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a