Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM50026045
Substrate/Competitorn/a
Meas. Tech.ChEMBL_61949
Ki 4603±n/a nM
Citation Thurkauf, AYuan, JChen, XWasley, JWMeade, RWoodruff, KHHuston, KRoss, PC 1-Phenyl-3-(aminomethyl)pyrroles as potential antipsychotic agents. Synthesis and dopamine receptor binding. J Med Chem38:4950-2 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:44355.59
Organism:Chlorocebus aethiops
Description:ChEMBL_105569
Residue:400
Sequence:
MAPLSQLSGHLNYTCGVENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRVCCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVTLMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDRAHLELKRYYSICQDTALGGPGFQERGGELKREERTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50026045
NameBDBM50026045
Synonyms:(R,S)-3-Bromo-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2,6-dimethoxy-benzamide | (S)-3-Bromo-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2,6-dimethoxy-benzamide | 3-Bromo-N-((R)-1-ethyl-pyrrolidin-2-ylmethyl)-2,6-dimethoxy-benzamide | 3-Bromo-N-((S)-1-ethyl-pyrrolidin-2-ylmethyl)-2,6-dimethoxy-benzamide | 3-Bromo-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2,6-dimethoxy-benzamide | 3-Bromo-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2,6-dimethoxy-benzamide (Remoxipride) | 3-Bromo-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2,6-dimethoxy-benzamide(remoxipride) | CHEMBL22242 | REMOXIPRIDE
TypeSmall organic molecule
Emp. Form.C16H23BrN2O3
Mol. Mass.371.269
SMILESCCN1CCC[C@H]1CNC(=O)c1c(OC)ccc(Br)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a