Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlucagon receptor
LigandBDBM50454201
Substrate/Competitorn/a
Meas. Tech.ChEMBL_70916
IC50 10±n/a nM
Citation Azizeh, BYShenderovich, MDTrivedi, DLi, GSturm, NSHruby, VJ Topographical amino acid substitution in position 10 of glucagon leads to antagonists/partial agonists with greater binding differences. J Med Chem39:2449-55 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glucagon receptor
Name:Glucagon receptor
Synonyms:GL-R
Type:PROTEIN
Mol. Mass.:55053.40
Organism:Rattus norvegicus
Description:ChEMBL_1450588
Residue:485
Sequence:
MLLTQLHCPYLLLLLVVLSCLPKAPSAQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCN
RTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQSWRDAS
QCQMDDDEIEVQKGVAKMYSSYQVMYTVGYSLSLGALLLALVILLGLRKLHCTRNYIHGN
LFASFVLKAGSVLVIDWLLKTRYSQKIGDDLSVSVWLSDGAVAGCRVATVIMQYGIIANY
CWLLVEGVYLYSLLSITTFSEKSFFSLYLCIGWGSPLLFVIPWVVVKCLFENVQCWTSND
NMGFWWILRIPVLLAILINFFIFVRIIHLLVAKLRAHQMHYADYKFRLARSTLTLIPLLG
VHEVVFAFVTDEHAQGTLRSTKLFFDLFFSSFQGLLVAVLYCFLNKEVQAELLRRWRRWQ
EGKALQEERMASSHGSHMAPAGTCHGDPCEKLQLMSAGSSSGTGCEPSAKTSLASSLPRL
ADSPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50454201
NameBDBM50454201
Synonyms:CHEMBL3037804
TypeSmall organic molecule
Emp. Form.C154H225N41O46S
Mol. Mass.3418.746
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a