Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM35538
Substrate/Competitorn/a
Meas. Tech.ChEMBL_159456
IC50>100000±n/a nM
Citation Mazumder, AWang, SNeamati, NNicklaus, MSunder, SChen, JMilne, GWRice, WGBurke, TRPommier, Y Antiretroviral agents as inhibitors of both human immunodeficiency virus type 1 integrase and protease. J Med Chem39:2472-81 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35538
NameBDBM35538
Synonyms:CHEMBL81697 | symmetric dicoumarol analogue, 14
TypeSmall organic molecule
Emp. Form.C22H16O8
Mol. Mass.408.3576
SMILESCCOC(=O)C(c1c(O)c2ccccc2oc1=O)c1c(O)c2ccccc2oc1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a