Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPenicillin-binding protein
LigandBDBM50053180
Substrate/Competitorn/a
Meas. Tech.ChEMBL_153673
IC50 14000±n/a nM
Citation Richter, HGAngehrn, PHubschwerlen, CKania, MPage, MGSpecklin, JLWinkler, FK Design, synthesis, and evaluation of 2 beta-alkenyl penam sulfone acids as inhibitors of beta-lactamases. J Med Chem39:3712-22 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Penicillin-binding protein
Name:Penicillin-binding protein
Synonyms:Penicillin-binding protein 4
Type:PROTEIN
Mol. Mass.:48251.55
Organism:Staphylococcus aureus
Description:ChEMBL_153674
Residue:431
Sequence:
MKNLISIIIILCLTLSIMTPYAQATNSDVTPVQAANQYGYAGLSAAYEPTSAVNVSQTGQ
LLYQYNIDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVTMTNKEYIMSTLPELSNTKL
YPGQVWTIADLLQITVSNSSNAAALILAKKVSKNTSDFVDLMNNKAKAIGMKNTHFVNPT
GAENSRLRTFAPTKYKDQERTVTTARDYAILDLHVIKETPKILDFTKQLAPTTLAVTYYT
FNFSLEGAKMSLPGTDGLKTGSSDTANYNHTITTKRGKFRINQVIMGAGDYKNLGGEKQR
NMMGNALMERSFDQYKYVKILSKGEQRINGKKYYVENDLYDVLPSDFSKKDYKLVVEDGK
VHADYPREFINKDYGPPTVEVHQPIIQKANTVAKSMWEEHPLFTIIGGTCLVAGLALIVH
MIINRLFRKRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50053180
NameBDBM50053180
Synonyms:CHEMBL332565 | Sodium; (2S,3S,5R)-3-methyl-4,4,7-trioxo-3-((Z)-2-thiazol-5-yl-vinyl)-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylate
TypeSmall organic molecule
Emp. Form.C12H11N2O5S2
Mol. Mass.327.357
SMILESC[C@]1(\C=C/c2cncs2)[C@@H](N2[C@@H](CC2=O)S1(=O)=O)C([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a