Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPenicillin-binding protein
LigandBDBM50053175
Substrate/Competitorn/a
Meas. Tech.ChEMBL_153658
IC50 100000±n/a nM
Citation Richter, HGAngehrn, PHubschwerlen, CKania, MPage, MGSpecklin, JLWinkler, FK Design, synthesis, and evaluation of 2 beta-alkenyl penam sulfone acids as inhibitors of beta-lactamases. J Med Chem39:3712-22 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Penicillin-binding protein
Name:Penicillin-binding protein
Synonyms:Penicillin-binding protein 2
Type:PROTEIN
Mol. Mass.:79295.25
Organism:Staphylococcus aureus
Description:ChEMBL_153530
Residue:716
Sequence:
MTENKGSSQPKKNGNNGGKSNSKKNRNVKRTIIKIIGFMIIAFFVVLLLGILLFAYYAWK
APAFTEAKLQDPIPAKIYDKNGELVKTLDNGQRHEHVNLKDVPKSMKDAVLATEDNRFYE
HGALDYKRLFGAIGKNLTGGFGSEGASTLTQQVVKDAFLSQHKSIGRKAQEAYLSYRLEQ
EYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLPQVPNNYNIY
DHPKAAEDRKNTVLYLMHYHKRITDKQWEDAKKIDLKANLVNRTAEERQNIDTNQDSEYN
SYVNFVKSELMNNKAFKDENLGNVLQSGIKIYTNMDKDVQKTLQNDVDNGSFYKNKDQQV
GATILDSKTGGLVAISGGRDFKDVVNRNQATDPHPTGSSLKPFLAYGPAIENMKWATNHA
IQDESSYQVDGSTFRNYDTKSHGTVSIYDALRQSFNIPALKAWQSVKQNAGNDAPKKFAA
KLGLNYEGDIGPSEVLGGSASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRDGETIEY
DHTSHKAMSDYTAYMLAEMLKGTFKPYGSAYGHGVSGVNMGAKTGTGTYGAETYSQYNLP
DNAAKDVWINGFTPQYTMSVWMGFSKVKQYGENSFVGHSQQEYPQFLYENVMSKISSRDG
EDFKRPSSVSGSIPSINVSGSQDNNTTNRSTHGGSDTSANSSGTAQSNNNTRSQQS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50053175
NameBDBM50053175
Synonyms:(2S,3S,5R)-3-Methyl-4,4,7-trioxo-3-((E)-2-thiazol-5-yl-vinyl)-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylic acid | CHEMBL333330
TypeSmall organic molecule
Emp. Form.C12H12N2O5S2
Mol. Mass.328.364
SMILESC[C@]1(\C=C\c2cncs2)[C@@H](N2[C@@H](CC2=O)S1(=O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a